SCOPe 2.08: Domain d5tudb1: 5tud B:1-105

Lineage for d5tudb1 (5tud B:1-105)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d5tudb1: 5tud B:1-105 [337067]
   Other proteins in same PDB: d5tudb2, d5tudc2, d5tude2, d5tudf2
   automated match to d1dn0a1
   complexed with erm

Details for d5tudb1

PDB Entry: 5tud, 3 Å

PDB Description: structural insights into the extracellular recognition of the human serotonin 2b receptor by an antibody

PDB Compounds: (B:) Anti-5-HT2B Fab light chain

SCOPe Domain Sequences for d5tudb1:

Sequence; same for both SEQRES and ATOM records:

>d5tudb1 b.1.1.0 (B:1-105) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divliqspaimsaspgekvtitcsasssvsymhwfqqkpgtspklwiystsnlasgvpar
fsgsgsgtsysltisrmeaedaatyycqqrssypltfgagtklei

Timeline for d5tudb1:

• d5tudb1 first appeared in SCOPe 2.06
  
• d5tudb1 appears in SCOPe 2.07