Lineage for d4ktqa1 (4ktq A:294-422)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1372364Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1373755Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 1374321Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (16 proteins)
    contains Pfam PF00929
  6. 1374442Protein Exonuclease domain of prokaryotic DNA polymerase [53119] (3 species)
    part of Klenow fragment, KF
  7. 1374508Species Thermus aquaticus [TaxId:271] [53121] (24 PDB entries)
  8. 1374531Domain d4ktqa1: 4ktq A:294-422 [33706]
    Other proteins in same PDB: d4ktqa2
    protein/DNA complex

Details for d4ktqa1

PDB Entry: 4ktq (more details), 2.5 Å

PDB Description: binary complex of the large fragment of dna polymerase i from t. aquaticus bound to a primer/template dna
PDB Compounds: (A:) protein (large fragment of DNA polymerase I)

SCOPe Domain Sequences for d4ktqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ktqa1 c.55.3.5 (A:294-422) Exonuclease domain of prokaryotic DNA polymerase {Thermus aquaticus [TaxId: 271]}
leeapwpppegafvgfvlsrkepmwadllalaaarggrvhrapepykalrdlkearglla
kdlsvlalreglglppgddpmllaylldpsnttpegvarryggewteeageraalserlf
anlwgrleg

SCOPe Domain Coordinates for d4ktqa1:

Click to download the PDB-style file with coordinates for d4ktqa1.
(The format of our PDB-style files is described here.)

Timeline for d4ktqa1: