SCOPe 2.08: Domain d5ohgh2: 5ohg H:141-431

Lineage for d5ohgh2 (5ohg H:141-431)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.1: Enolase [51605] (2 proteins)
   automatically mapped to Pfam PF00113

6. Protein automated matches [226973] (7 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [337032] (1 PDB entry)

8. Domain d5ohgh2: 5ohg H:141-431 [337053]
   Other proteins in same PDB: d5ohga1, d5ohgb1, d5ohgh1, d5ohgi1
   automated match to d2fymc1
   complexed with mg, na, po4

Details for d5ohgh2

PDB Entry: 5ohg, 2 Å

PDB Description: enolase in complex with rnase e

PDB Compounds: (H:) enolase

SCOPe Domain Sequences for d5ohgh2:

Sequence; same for both SEQRES and ATOM records:

>d5ohgh2 c.1.11.1 (H:141-431) automated matches {Escherichia coli [TaxId: 83333]}
pgkysmpvpmmniinggehadnnvdiqefmiqpvgaktvkeairmgsevfhhlakvlkak
gmntavgdeggyapnlgsnaealaviaeavkaagyelgkditlamdcaasefykdgkyvl
agegnkaftseefthfleeltkqypivsiedgldesdwdgfayqtkvlgdkiqlvgddlf
vtntkilkegiekgiansilikfnqigsltetlaaikmakdagytavishrsgetedati
adlavgtaagqiktgsmsrsdrvakynqlirieealgekapyngrkeikgq

Timeline for d5ohgh2:

• d5ohgh2 first appeared in SCOPe 2.06
  
• d5ohgh2 appears in SCOPe 2.07