Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
Family c.1.11.1: Enolase [51605] (2 proteins) automatically mapped to Pfam PF00113 |
Protein automated matches [226973] (7 species) not a true protein |
Species Escherichia coli [TaxId:83333] [337032] (1 PDB entry) |
Domain d5ohgh2: 5ohg H:141-431 [337053] Other proteins in same PDB: d5ohga1, d5ohgb1, d5ohgh1, d5ohgi1 automated match to d2fymc1 complexed with mg, na, po4 |
PDB Entry: 5ohg (more details), 2 Å
SCOPe Domain Sequences for d5ohgh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ohgh2 c.1.11.1 (H:141-431) automated matches {Escherichia coli [TaxId: 83333]} pgkysmpvpmmniinggehadnnvdiqefmiqpvgaktvkeairmgsevfhhlakvlkak gmntavgdeggyapnlgsnaealaviaeavkaagyelgkditlamdcaasefykdgkyvl agegnkaftseefthfleeltkqypivsiedgldesdwdgfayqtkvlgdkiqlvgddlf vtntkilkegiekgiansilikfnqigsltetlaaikmakdagytavishrsgetedati adlavgtaagqiktgsmsrsdrvakynqlirieealgekapyngrkeikgq
Timeline for d5ohgh2: