Lineage for d5gnhb1 (5gnh B:75-198)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2070980Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2070981Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2071503Family b.55.1.8: GRAM domain [101839] (1 protein)
  6. 2071504Protein Myotubularin-related protein 2, N-terminal domain [101840] (1 species)
  7. 2071505Species Human (Homo sapiens) [TaxId:9606] [101841] (5 PDB entries)
  8. 2071512Domain d5gnhb1: 5gnh B:75-198 [337050]
    Other proteins in same PDB: d5gnha2, d5gnhb2
    automated match to d1lw3a1
    complexed with po4

Details for d5gnhb1

PDB Entry: 5gnh (more details), 2.6 Å

PDB Description: myotubularin-related protein 2
PDB Compounds: (B:) Myotubularin-related protein 2

SCOPe Domain Sequences for d5gnhb1:

Sequence, based on SEQRES records: (download)

>d5gnhb1 b.55.1.8 (B:75-198) Myotubularin-related protein 2, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
eppllpgenikdmakdvtyicpftgavrgtltvtnyrlyfksmerdppfvldaslgvinr
vekiggassrgensygletvckdirnlrfahkpegrtrrsifenlmkyafpvsnnlplfa
feyk

Sequence, based on observed residues (ATOM records): (download)

>d5gnhb1 b.55.1.8 (B:75-198) Myotubularin-related protein 2, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
eppllpgenikdmakdvtyicpftgavrgtltvtnyrlyfksmerdppfvldaslgvinr
vekiggnsygletvckdirnlrfahkpegrtrrsifenlmkyafpvsnnlplfafeyk

SCOPe Domain Coordinates for d5gnhb1:

Click to download the PDB-style file with coordinates for d5gnhb1.
(The format of our PDB-style files is described here.)

Timeline for d5gnhb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5gnhb2