Class b: All beta proteins [48724] (177 folds) |
Fold b.55: PH domain-like barrel [50728] (2 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (14 families) |
Family b.55.1.8: GRAM domain [101839] (1 protein) |
Protein Myotubularin-related protein 2, N-terminal domain [101840] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [101841] (5 PDB entries) |
Domain d5gnhb1: 5gnh B:75-198 [337050] Other proteins in same PDB: d5gnha2, d5gnhb2 automated match to d1lw3a1 complexed with po4 |
PDB Entry: 5gnh (more details), 2.6 Å
SCOPe Domain Sequences for d5gnhb1:
Sequence, based on SEQRES records: (download)
>d5gnhb1 b.55.1.8 (B:75-198) Myotubularin-related protein 2, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} eppllpgenikdmakdvtyicpftgavrgtltvtnyrlyfksmerdppfvldaslgvinr vekiggassrgensygletvckdirnlrfahkpegrtrrsifenlmkyafpvsnnlplfa feyk
>d5gnhb1 b.55.1.8 (B:75-198) Myotubularin-related protein 2, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} eppllpgenikdmakdvtyicpftgavrgtltvtnyrlyfksmerdppfvldaslgvinr vekiggnsygletvckdirnlrfahkpegrtrrsifenlmkyafpvsnnlplfafeyk
Timeline for d5gnhb1: