SCOPe 2.03: Domain d1jxea1: 1jxe A:293-422

Lineage for d1jxea1 (1jxe A:293-422)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (16 proteins)
   contains Pfam PF00929

6. Protein Exonuclease domain of prokaryotic DNA polymerase [53119] (3 species)
   part of Klenow fragment, KF

7. Species Thermus aquaticus [TaxId:271] [53121] (24 PDB entries)

8. Domain d1jxea1: 1jxe A:293-422 [33705]
   Other proteins in same PDB: d1jxea2

Details for d1jxea1

PDB Entry: 1jxe, 2.85 Å

PDB Description: stoffel fragment of taq dna polymerase i

PDB Compounds: (A:) taq DNA polymerase I

SCOPe Domain Sequences for d1jxea1:

Sequence; same for both SEQRES and ATOM records:

>d1jxea1 c.55.3.5 (A:293-422) Exonuclease domain of prokaryotic DNA polymerase {Thermus aquaticus [TaxId: 271]}
aleeapwpppegafvgfvlsrkepmwadllalaaarggrvhrapepykalrdlkeargll
akdlsvlalreglglppgddpmllaylldpsnttpegvarryggewteeageraalserl
fanlwgrleg

Timeline for d1jxea1:

• d1jxea1 first appeared (with stable ids) in SCOP 1.55, called d1jxe_1
  
• d1jxea1 appears in SCOPe 2.02
  
• d1jxea1 appears in SCOPe 2.04
  
• d1jxea1 appears in the current release, SCOPe 2.08