Lineage for d1jxe_1 (1jxe 293-422)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 397315Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 397627Superfamily c.55.3: Ribonuclease H-like [53098] (9 families) (S)
    consists of one domain of this fold
  5. 397834Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (7 proteins)
  6. 397868Protein Exonuclease domain of prokaryotic DNA polymerase [53119] (3 species)
    part of Klenow fragment, KF
  7. 397910Species Thermus aquaticus [TaxId:271] [53121] (13 PDB entries)
  8. 397921Domain d1jxe_1: 1jxe 293-422 [33705]
    Other proteins in same PDB: d1jxe_2

Details for d1jxe_1

PDB Entry: 1jxe (more details), 2.85 Å

PDB Description: stoffel fragment of taq dna polymerase i

SCOP Domain Sequences for d1jxe_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jxe_1 c.55.3.5 (293-422) Exonuclease domain of prokaryotic DNA polymerase {Thermus aquaticus}
aleeapwpppegafvgfvlsrkepmwadllalaaarggrvhrapepykalrdlkeargll
akdlsvlalreglglppgddpmllaylldpsnttpegvarryggewteeageraalserl
fanlwgrleg

SCOP Domain Coordinates for d1jxe_1:

Click to download the PDB-style file with coordinates for d1jxe_1.
(The format of our PDB-style files is described here.)

Timeline for d1jxe_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jxe_2