Lineage for d5ohgi1 (5ohg I:1-140)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947581Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2947582Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2947878Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2947879Protein automated matches [226922] (95 species)
    not a true protein
  7. 2948240Species Escherichia coli [TaxId:83333] [337030] (1 PDB entry)
  8. 2948244Domain d5ohgi1: 5ohg I:1-140 [337031]
    Other proteins in same PDB: d5ohga2, d5ohgb2, d5ohgh2, d5ohgi2
    automated match to d2fyma2
    complexed with mg, na, po4

Details for d5ohgi1

PDB Entry: 5ohg (more details), 2 Å

PDB Description: enolase in complex with rnase e
PDB Compounds: (I:) enolase

SCOPe Domain Sequences for d5ohgi1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ohgi1 d.54.1.0 (I:1-140) automated matches {Escherichia coli [TaxId: 83333]}
mskivkiigreiidsrgnptveaevhleggfvgmaaapsgastgsrealelrdgdksrfl
gkgvtkavaavngpiaqaligkdakdqagidkimidldgtenkskfganailavslanak
aaaaakgmplyehiaelngt

SCOPe Domain Coordinates for d5ohgi1:

Click to download the PDB-style file with coordinates for d5ohgi1.
(The format of our PDB-style files is described here.)

Timeline for d5ohgi1: