SCOPe 2.08: Domain d5ng9a1: 5ng9 A:3-263

Lineage for d5ng9a1 (5ng9 A:3-263)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
   has additional insertions and/or extensions that are not grouped together
   

6. Protein automated matches [190140] (37 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [189278] (36 PDB entries)

8. Domain d5ng9a1: 5ng9 A:3-263 [337028]
   Other proteins in same PDB: d5ng9a2
   automated match to d5ftia_
   complexed with 8vn, 8wq, flc, gol, li, so4

Details for d5ng9a1

PDB Entry: 5ng9, 1.15 Å

PDB Description: crystal structure of the glua2 ligand-binding domain (s1s2j) in complex with agonist cip-as at 1.15 a resolution.

PDB Compounds: (A:) Glutamate receptor 2

SCOPe Domain Sequences for d5ng9a1:

Sequence; same for both SEQRES and ATOM records:

>d5ng9a1 c.94.1.1 (A:3-263) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
nktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyg
ardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpie
saedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvr
kskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlkln
eqglldklknkwwydkgecgs

Timeline for d5ng9a1:

• d5ng9a1 first appeared in SCOPe 2.06
  
• d5ng9a1 appears in SCOPe 2.07