SCOPe 2.08: Domain d5mxub1: 5mxu B:6-273

Lineage for d5mxub1 (5mxu B:6-273)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
   consists of two alpha+beta subdomains

4. Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families)

5. Family d.145.1.1: FAD-linked oxidases, N-terminal domain [56177] (8 proteins)

6. Protein automated matches [254445] (3 species)
   not a true protein

7. Species Fungus (Penicillium simplicissimum) [TaxId:69488] [336989] (2 PDB entries)

8. Domain d5mxub1: 5mxu B:6-273 [337024]
   Other proteins in same PDB: d5mxua2, d5mxub2
   automated match to d1qlta2
   complexed with fad, gol; mutant

Details for d5mxub1

PDB Entry: 5mxu, 2.8 Å

PDB Description: structure of the y503f mutant of vanillyl alcohol oxidase

PDB Compounds: (B:) vanillyl-alcohol oxidase

SCOPe Domain Sequences for d5mxub1:

Sequence; same for both SEQRES and ATOM records:

>d5mxub1 d.145.1.1 (B:6-273) automated matches {Fungus (Penicillium simplicissimum) [TaxId: 69488]}
efrpltlppklslsdfnefiqdiirivgsenvevisskdqivdgsymkpththdphhvmd
qdyflasaivaprnvadvqsivglankfsfplwpisigrnsgyggaaprvsgsvvldmgk
nmnrvlevnvegaycvvepgvtyhdlhnyleannlrdklwldvpdlgggsvlgnavergv
gytpygdhwmmhsgmevvlangellrtgmgalpdpkrpetmglkpedqpwskiahlfpyg
fgpyidglfsqsnmgivtkigiwlmpnp

Timeline for d5mxub1:

• d5mxub1 first appeared in SCOPe 2.06
  
• d5mxub1 appears in SCOPe 2.07