| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) ![]() consists of one domain of this fold |
| Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (16 proteins) contains Pfam PF00929 |
| Protein Exonuclease domain of prokaryotic DNA polymerase [53119] (3 species) part of Klenow fragment, KF |
| Species Thermus aquaticus [TaxId:271] [53121] (24 PDB entries) |
| Domain d2ktqa1: 2ktq A:295-422 [33702] Other proteins in same PDB: d2ktqa2 protein/DNA complex; complexed with dct, mg |
PDB Entry: 2ktq (more details), 2.3 Å
SCOPe Domain Sequences for d2ktqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ktqa1 c.55.3.5 (A:295-422) Exonuclease domain of prokaryotic DNA polymerase {Thermus aquaticus [TaxId: 271]}
eeapwpppegafvgfvlsrkepmwadllalaaarggrvhrapepykalrdlkeargllak
dlsvlalreglglppgddpmllaylldpsnttpegvarryggewteeageraalserlfa
nlwgrleg
Timeline for d2ktqa1: