Lineage for d5nvmc1 (5nvm C:52-219)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2962641Fold d.86: eIF4e-like [55417] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha-beta(2)-alpha-beta-2; 2 layers: alpha/beta; antiparallel sheet: 21356478
  4. 2962642Superfamily d.86.1: eIF4e-like [55418] (3 families) (S)
  5. 2962762Family d.86.1.0: automated matches [191459] (1 protein)
    not a true family
  6. 2962763Protein automated matches [190708] (10 species)
    not a true protein
  7. 2962799Species Human (Homo sapiens) [TaxId:9606] [187914] (8 PDB entries)
  8. 2962806Domain d5nvmc1: 5nvm C:52-219 [337013]
    Other proteins in same PDB: d5nvma2, d5nvmc2
    automated match to d2jgba_
    complexed with po4

Details for d5nvmc1

PDB Entry: 5nvm (more details), 2 Å

PDB Description: crystal structure of the human 4ehp-gigyf2 complex lacking the auxiliary sequences
PDB Compounds: (C:) eukaryotic translation initiation factor 4e type 2

SCOPe Domain Sequences for d5nvmc1:

Sequence, based on SEQRES records: (download)

>d5nvmc1 d.86.1.0 (C:52-219) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aehplqynytfwysrrtpgrptssqsyeqnikqigtfasveqfwrfyshmvrpgdltghs
dfhlfkegikpmweddanknggkwiirlrkglasrcwenlilamlgeqfmvgeeicgavv
svrfqediisiwnktasdqattarirdtlrrvlnlppntimeykthtd

Sequence, based on observed residues (ATOM records): (download)

>d5nvmc1 d.86.1.0 (C:52-219) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aehplqynytfwysrrqnikqigtfasveqfwrfyshmvrpgdltghsdfhlfkegikpm
weddanknggkwiirlrkglasrcwenlilamlgeqfmvgeeicgavvsvrfqediisiw
nktasdqattarirdtlrrvlnlppntimeykthtd

SCOPe Domain Coordinates for d5nvmc1:

Click to download the PDB-style file with coordinates for d5nvmc1.
(The format of our PDB-style files is described here.)

Timeline for d5nvmc1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5nvmc2