Lineage for d1cmwa3 (1cmw A:290-422)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 25007Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
  4. 25212Superfamily c.55.3: Ribonuclease H-like [53098] (6 families) (S)
  5. 25363Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (4 proteins)
  6. 25384Protein Exonuclease domain of prokaryotic DNA polymerase [53119] (3 species)
  7. 25405Species Thermus aquaticus [TaxId:271] [53121] (13 PDB entries)
  8. 25409Domain d1cmwa3: 1cmw A:290-422 [33701]
    Other proteins in same PDB: d1cmwa1, d1cmwa2, d1cmwa4

Details for d1cmwa3

PDB Entry: 1cmw (more details), 2.6 Å

PDB Description: crystal structure of taq dna-polymerase shows a new orientation for the structure-specific nuclease domain

SCOP Domain Sequences for d1cmwa3:

Sequence, based on SEQRES records: (download)

>d1cmwa3 c.55.3.5 (A:290-422) Exonuclease domain of prokaryotic DNA polymerase {Thermus aquaticus}
spkaleeapwpppegafvgfvlsrkepmwadllalaaarggrvhrapepykalrdlkear
gllakdlsvlalreglglppgddpmllaylldpsnttpegvarryggewteeageraals
erlfanlwgrleg

Sequence, based on observed residues (ATOM records): (download)

>d1cmwa3 c.55.3.5 (A:290-422) Exonuclease domain of prokaryotic DNA polymerase {Thermus aquaticus}
spaleeapwpppegafvgfvlsrkepmwadllalaaarggrvhrapepykalrdlkearg
llakdlsvlalreglglppgddpmllaylldpsnttpegvarryggewteeageraalse
rlfanlwgrleg

SCOP Domain Coordinates for d1cmwa3:

Click to download the PDB-style file with coordinates for d1cmwa3.
(The format of our PDB-style files is described here.)

Timeline for d1cmwa3: