Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.86: eIF4e-like [55417] (1 superfamily) beta(2)-alpha-beta(2)-alpha-beta(2)-alpha-beta-2; 2 layers: alpha/beta; antiparallel sheet: 21356478 |
Superfamily d.86.1: eIF4e-like [55418] (3 families) |
Family d.86.1.0: automated matches [191459] (1 protein) not a true family |
Protein automated matches [190708] (10 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187914] (8 PDB entries) |
Domain d5nvlc1: 5nvl C:52-218 [337004] Other proteins in same PDB: d5nvla2, d5nvlc2 automated match to d2jgba_ |
PDB Entry: 5nvl (more details), 2.3 Å
SCOPe Domain Sequences for d5nvlc1:
Sequence, based on SEQRES records: (download)
>d5nvlc1 d.86.1.0 (C:52-218) automated matches {Human (Homo sapiens) [TaxId: 9606]} aehplqynytfwysrrtpgrptssqsyeqnikqigtfasveqfwrfyshmvrpgdltghs dfhlfkegikpmweddanknggkwiirlrkglasrcwenlilamlgeqfmvgeeicgavv svrfqediisiwnktasdqattarirdtlrrvlnlppntimeyktht
>d5nvlc1 d.86.1.0 (C:52-218) automated matches {Human (Homo sapiens) [TaxId: 9606]} aehplqynytfwysrrtnikqigtfasveqfwrfyshmvrpgdltghsdfhlfkegikpm weddanknggkwiirlrkglasrcwenlilamlgeqfmvgeeicgavvsvrfqediisiw nktasdqattarirdtlrrvlnlppntimeyktht
Timeline for d5nvlc1: