Lineage for d5mxjb2 (5mxj B:274-560)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2955209Superfamily d.58.32: FAD-linked oxidases, C-terminal domain [55103] (7 families) (S)
    duplication: contains two subdomains of this fold
  5. 2955210Family d.58.32.1: Vanillyl-alcohol oxidase-like [55104] (3 proteins)
    automatically mapped to Pfam PF02913
  6. 2955251Protein automated matches [254446] (2 species)
    not a true protein
  7. 2955252Species Fungus (Penicillium simplicissimum) [TaxId:69488] [336991] (2 PDB entries)
  8. 2955256Domain d5mxjb2: 5mxj B:274-560 [337003]
    Other proteins in same PDB: d5mxja1, d5mxjb1
    automated match to d1vaoa1
    complexed with fad, gol; mutant

Details for d5mxjb2

PDB Entry: 5mxj (more details), 2.8 Å

PDB Description: structure of the y108f mutant of vanillyl alcohol oxidase
PDB Compounds: (B:) vanillyl-alcohol oxidase

SCOPe Domain Sequences for d5mxjb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mxjb2 d.58.32.1 (B:274-560) automated matches {Fungus (Penicillium simplicissimum) [TaxId: 69488]}
rgyqsylitlpkdgdlkqavdiirplrlgmalqnvptirhilldaavlgdkrsyssrtep
lsdeeldkiakqlnlgrwnfygalygpepirrvlwetikdafsaipgvkfyfpedtpens
vlrvrdktmqgiptydelkwidwlpngahlffspiakvsgedammqyavtkkrcqeagld
figtftvgmremhhivcivfnkkdliqkrkvqwlmrtliddcaangwgeyrthlafmdqi
metynwnnssflrfnevlknavdpngiiapgksgvwpsqyshvtwkl

SCOPe Domain Coordinates for d5mxjb2:

Click to download the PDB-style file with coordinates for d5mxjb2.
(The format of our PDB-style files is described here.)

Timeline for d5mxjb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5mxjb1