Lineage for d5mxjb1 (5mxj B:6-273)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2987459Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 2987460Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) (S)
  5. 2987461Family d.145.1.1: FAD-linked oxidases, N-terminal domain [56177] (8 proteins)
  6. 2987531Protein automated matches [254445] (3 species)
    not a true protein
  7. 2987537Species Fungus (Penicillium simplicissimum) [TaxId:69488] [336989] (2 PDB entries)
  8. 2987541Domain d5mxjb1: 5mxj B:6-273 [337001]
    Other proteins in same PDB: d5mxja2, d5mxjb2
    automated match to d1qlta2
    complexed with fad, gol; mutant

Details for d5mxjb1

PDB Entry: 5mxj (more details), 2.8 Å

PDB Description: structure of the y108f mutant of vanillyl alcohol oxidase
PDB Compounds: (B:) vanillyl-alcohol oxidase

SCOPe Domain Sequences for d5mxjb1:

Sequence, based on SEQRES records: (download)

>d5mxjb1 d.145.1.1 (B:6-273) automated matches {Fungus (Penicillium simplicissimum) [TaxId: 69488]}
efrpltlppklslsdfnefiqdiirivgsenvevisskdqivdgsymkpththdphhvmd
qdyflasaivaprnvadvqsivglankfsfplwpisigrnsgfggaaprvsgsvvldmgk
nmnrvlevnvegaycvvepgvtyhdlhnyleannlrdklwldvpdlgggsvlgnavergv
gytpygdhwmmhsgmevvlangellrtgmgalpdpkrpetmglkpedqpwskiahlfpyg
fgpyidglfsqsnmgivtkigiwlmpnp

Sequence, based on observed residues (ATOM records): (download)

>d5mxjb1 d.145.1.1 (B:6-273) automated matches {Fungus (Penicillium simplicissimum) [TaxId: 69488]}
efrpltlppklslsdfnefiqdiirivgsenvevisskivdgsymkpththdphhvmdqd
yflasaivaprnvadvqsivglankfsfplwpisigrnsgfggaaprvsgsvvldmgknm
nrvlevnvegaycvvepgvtyhdlhnyleannlrdklwldvpdlgggsvlgnavergvgy
tpygdhwmmhsgmevvlangellrtgmgalpdpkrpetmglkpedqpwskiahlfpygfg
pyidglfsqsnmgivtkigiwlmpnp

SCOPe Domain Coordinates for d5mxjb1:

Click to download the PDB-style file with coordinates for d5mxjb1.
(The format of our PDB-style files is described here.)

Timeline for d5mxjb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5mxjb2