Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) consists of one domain of this fold |
Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 proteins) contains Pfam PF00929 |
Protein Exonuclease domain of prokaryotic DNA polymerase [53119] (3 species) part of Klenow fragment, KF |
Species Thermus aquaticus [TaxId:271] [53121] (29 PDB entries) |
Domain d1qsya1: 1qsy A:293-422 [33700] Other proteins in same PDB: d1qsya2 protein/DNA complex; complexed with dds, mg |
PDB Entry: 1qsy (more details), 2.3 Å
SCOPe Domain Sequences for d1qsya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qsya1 c.55.3.5 (A:293-422) Exonuclease domain of prokaryotic DNA polymerase {Thermus aquaticus [TaxId: 271]} aleeapwpppegafvgfvlsrkepmwadllalaaarggrvhrapepykalrdlkeergll akdlsvlalreglglppgddpmllaylldpsnttpegvarryggewteeageraalserl fanlwgrleg
Timeline for d1qsya1: