![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.32: FAD-linked oxidases, C-terminal domain [55103] (7 families) ![]() duplication: contains two subdomains of this fold |
![]() | Family d.58.32.1: Vanillyl-alcohol oxidase-like [55104] (3 proteins) automatically mapped to Pfam PF02913 |
![]() | Protein automated matches [254446] (2 species) not a true protein |
![]() | Species Penicillium simplicissimum [TaxId:69488] [336991] (2 PDB entries) |
![]() | Domain d5mxja2: 5mxj A:274-560 [336992] Other proteins in same PDB: d5mxja1, d5mxjb1 automated match to d1vaoa1 complexed with fad, gol; mutant |
PDB Entry: 5mxj (more details), 2.8 Å
SCOPe Domain Sequences for d5mxja2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5mxja2 d.58.32.1 (A:274-560) automated matches {Penicillium simplicissimum [TaxId: 69488]} rgyqsylitlpkdgdlkqavdiirplrlgmalqnvptirhilldaavlgdkrsyssrtep lsdeeldkiakqlnlgrwnfygalygpepirrvlwetikdafsaipgvkfyfpedtpens vlrvrdktmqgiptydelkwidwlpngahlffspiakvsgedammqyavtkkrcqeagld figtftvgmremhhivcivfnkkdliqkrkvqwlmrtliddcaangwgeyrthlafmdqi metynwnnssflrfnevlknavdpngiiapgksgvwpsqyshvtwkl
Timeline for d5mxja2: