SCOPe 2.08: Domain d5nvma1: 5nvm A:52-221

Lineage for d5nvma1 (5nvm A:52-221)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.86: eIF4e-like [55417] (1 superfamily)
   beta(2)-alpha-beta(2)-alpha-beta(2)-alpha-beta-2; 2 layers: alpha/beta; antiparallel sheet: 21356478

4. Superfamily d.86.1: eIF4e-like [55418] (3 families)

5. Family d.86.1.0: automated matches [191459] (1 protein)
   not a true family

6. Protein automated matches [190708] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187914] (8 PDB entries)

8. Domain d5nvma1: 5nvm A:52-221 [336987]
   Other proteins in same PDB: d5nvma2, d5nvmc2
   automated match to d2jgba_
   complexed with po4

Details for d5nvma1

PDB Entry: 5nvm, 2 Å

PDB Description: crystal structure of the human 4ehp-gigyf2 complex lacking the auxiliary sequences

PDB Compounds: (A:) eukaryotic translation initiation factor 4e type 2

SCOPe Domain Sequences for d5nvma1:

Sequence; same for both SEQRES and ATOM records:

>d5nvma1 d.86.1.0 (A:52-221) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aehplqynytfwysrrtpgrptssqsyeqnikqigtfasveqfwrfyshmvrpgdltghs
dfhlfkegikpmweddanknggkwiirlrkglasrcwenlilamlgeqfmvgeeicgavv
svrfqediisiwnktasdqattarirdtlrrvlnlppntimeykthtdsi

Timeline for d5nvma1:

• d5nvma1 first appeared in SCOPe 2.06
  
• d5nvma1 appears in SCOPe 2.07