SCOPe 2.07: Domain d1taqa3: 1taq A:290-422

Lineage for d1taqa3 (1taq A:290-422)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (16 families)
   consists of one domain of this fold

5. Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 proteins)
   contains Pfam PF00929

6. Protein Exonuclease domain of prokaryotic DNA polymerase [53119] (3 species)
   part of Klenow fragment, KF

7. Species Thermus aquaticus [TaxId:271] [53121] (29 PDB entries)

8. Domain d1taqa3: 1taq A:290-422 [33698]
   Other proteins in same PDB: d1taqa1, d1taqa2, d1taqa4
   complexed with bgl, zn

Details for d1taqa3

PDB Entry: 1taq, 2.4 Å

PDB Description: structure of taq dna polymerase

PDB Compounds: (A:) taq DNA polymerase

SCOPe Domain Sequences for d1taqa3:

Sequence; same for both SEQRES and ATOM records:

>d1taqa3 c.55.3.5 (A:290-422) Exonuclease domain of prokaryotic DNA polymerase {Thermus aquaticus [TaxId: 271]}
spkaleeapwpppegafvgfvlsrkepmwadllalaaarggrvhrapepykalrdlkear
gllakdlsvlalreglglppgddpmllaylldpsnttpegvarryggewteeageraals
erlfanlwgrleg

Timeline for d1taqa3:

• d1taqa3 first appeared (with stable ids) in SCOP 1.55, called d1taq_3
  
• d1taqa3 appears in SCOPe 2.06
  
• d1taqa3 appears in the current release, SCOPe 2.08