Lineage for d1taqa3 (1taq A:290-422)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 835945Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 836757Superfamily c.55.3: Ribonuclease H-like [53098] (14 families) (S)
    consists of one domain of this fold
  5. 837032Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (15 proteins)
    contains Pfam PF00929
  6. 837107Protein Exonuclease domain of prokaryotic DNA polymerase [53119] (3 species)
    part of Klenow fragment, KF
  7. 837170Species Thermus aquaticus [TaxId:271] [53121] (13 PDB entries)
  8. 837178Domain d1taqa3: 1taq A:290-422 [33698]
    Other proteins in same PDB: d1taqa1, d1taqa2, d1taqa4
    complexed with bgl, zn; mutant

Details for d1taqa3

PDB Entry: 1taq (more details), 2.4 Å

PDB Description: structure of taq dna polymerase
PDB Compounds: (A:) taq DNA polymerase

SCOP Domain Sequences for d1taqa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1taqa3 c.55.3.5 (A:290-422) Exonuclease domain of prokaryotic DNA polymerase {Thermus aquaticus [TaxId: 271]}
spkaleeapwpppegafvgfvlsrkepmwadllalaaarggrvhrapepykalrdlkear
gllakdlsvlalreglglppgddpmllaylldpsnttpegvarryggewteeageraals
erlfanlwgrleg

SCOP Domain Coordinates for d1taqa3:

Click to download the PDB-style file with coordinates for d1taqa3.
(The format of our PDB-style files is described here.)

Timeline for d1taqa3: