SCOP 1.69: Domain d1taq_3: 1taq 290-422

Lineage for d1taq_3 (1taq 290-422)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (10 families)
   consists of one domain of this fold

5. Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (7 proteins)

6. Protein Exonuclease domain of prokaryotic DNA polymerase [53119] (3 species)
   part of Klenow fragment, KF

7. Species Thermus aquaticus [TaxId:271] [53121] (13 PDB entries)

8. Domain d1taq_3: 1taq 290-422 [33698]
   Other proteins in same PDB: d1taq_1, d1taq_2, d1taq_4

Details for d1taq_3

PDB Entry: 1taq, 2.4 Å

PDB Description: structure of taq dna polymerase

SCOP Domain Sequences for d1taq_3:

Sequence; same for both SEQRES and ATOM records:

>d1taq_3 c.55.3.5 (290-422) Exonuclease domain of prokaryotic DNA polymerase {Thermus aquaticus}
spkaleeapwpppegafvgfvlsrkepmwadllalaaarggrvhrapepykalrdlkear
gllakdlsvlalreglglppgddpmllaylldpsnttpegvarryggewteeageraals
erlfanlwgrleg

Timeline for d1taq_3:

• d1taq_3 first appeared (with stable ids) in SCOP 1.55
  
• d1taq_3 appears in SCOP 1.67
  
• d1taq_3 appears in SCOP 1.71
  
• d1taq_3 appears in the current release, SCOPe 2.08, called d1taqa3