Lineage for d5go2c_ (5go2 C:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.130: Chorismate mutase II [48599] (1 superfamily)
    multihelical; core: 6 helices, bundle
  4. Superfamily a.130.1: Chorismate mutase II [48600] (5 families) (S)
  5. Family a.130.1.0: automated matches [237401] (1 protein)
    not a true family
  6. Protein automated matches [237402] (7 species)
    not a true protein
  7. Species Bacillus subtilis [TaxId:224308] [336929] (2 PDB entries)
  8. Domain d5go2c_: 5go2 C: [336979]
    automated match to d2d8ea_
    complexed with cit, so4

Details for d5go2c_

PDB Entry: 5go2 (more details), 1.91 Å

PDB Description: crystal structure of chorismate mutase like domain of bifunctional dahp synthase of bacillus subtilis in complex with citrate
PDB Compounds: (C:) Protein AroA(G)

SCOPe Domain Sequences for d5go2c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5go2c_ a.130.1.0 (C:) automated matches {Bacillus subtilis [TaxId: 224308]}
sntelellrqkadelnlqilklinergnvvkeigkakeaqgvnrfdpvrertmlnniien
ndgpfenstiqhifkeifkaglelqee

SCOPe Domain Coordinates for d5go2c_ are not available.

Timeline for d5go2c_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5go2a_, d5go2b_, d5go2d_