Lineage for d5go2b_ (5go2 B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2732498Fold a.130: Chorismate mutase II [48599] (1 superfamily)
    multihelical; core: 6 helices, bundle
  4. 2732499Superfamily a.130.1: Chorismate mutase II [48600] (5 families) (S)
  5. 2732568Family a.130.1.0: automated matches [237401] (1 protein)
    not a true family
  6. 2732569Protein automated matches [237402] (7 species)
    not a true protein
  7. 2732570Species Bacillus subtilis [TaxId:224308] [336929] (2 PDB entries)
  8. 2732574Domain d5go2b_: 5go2 B: [336960]
    automated match to d2d8ea_
    complexed with cit, so4

Details for d5go2b_

PDB Entry: 5go2 (more details), 1.91 Å

PDB Description: crystal structure of chorismate mutase like domain of bifunctional dahp synthase of bacillus subtilis in complex with citrate
PDB Compounds: (B:) Protein AroA(G)

SCOPe Domain Sequences for d5go2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5go2b_ a.130.1.0 (B:) automated matches {Bacillus subtilis [TaxId: 224308]}
msntelellrqkadelnlqilklinergnvvkeigkakeaqgvnrfdpvrertmlnniie
nndgpfenstiqhifkeifkaglelqee

SCOPe Domain Coordinates for d5go2b_:

Click to download the PDB-style file with coordinates for d5go2b_.
(The format of our PDB-style files is described here.)

Timeline for d5go2b_: