Class a: All alpha proteins [46456] (290 folds) |
Fold a.130: Chorismate mutase II [48599] (1 superfamily) multihelical; core: 6 helices, bundle |
Superfamily a.130.1: Chorismate mutase II [48600] (5 families) |
Family a.130.1.0: automated matches [237401] (1 protein) not a true family |
Protein automated matches [237402] (7 species) not a true protein |
Species Bacillus subtilis [TaxId:224308] [336929] (2 PDB entries) |
Domain d5go2b_: 5go2 B: [336960] automated match to d2d8ea_ complexed with cit, so4 |
PDB Entry: 5go2 (more details), 1.91 Å
SCOPe Domain Sequences for d5go2b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5go2b_ a.130.1.0 (B:) automated matches {Bacillus subtilis [TaxId: 224308]} msntelellrqkadelnlqilklinergnvvkeigkakeaqgvnrfdpvrertmlnniie nndgpfenstiqhifkeifkaglelqee
Timeline for d5go2b_: