SCOP 1.67: Domain d3ktqa1: 3ktq A:293-422

Lineage for d3ktqa1 (3ktq A:293-422)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (9 families)
   consists of one domain of this fold

5. Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (7 proteins)

6. Protein Exonuclease domain of prokaryotic DNA polymerase [53119] (3 species)
   part of Klenow fragment, KF

7. Species Thermus aquaticus [TaxId:271] [53121] (13 PDB entries)

8. Domain d3ktqa1: 3ktq A:293-422 [33696]
   Other proteins in same PDB: d3ktqa2
   complexed with ctp, ddc, mg

Details for d3ktqa1

PDB Entry: 3ktq, 2.3 Å

PDB Description: crystal structure of an active ternary complex of the large fragment of dna polymerase i from thermus aquaticus

SCOP Domain Sequences for d3ktqa1:

Sequence; same for both SEQRES and ATOM records:

>d3ktqa1 c.55.3.5 (A:293-422) Exonuclease domain of prokaryotic DNA polymerase {Thermus aquaticus}
aleeapwpppegafvgfvlsrkepmwadllalaaarggrvhrapepykalrdlkeargll
akdlsvlalreglglppgddpmllaylldpsnttpegvarryggewteeageraalserl
fanlwgrleg

Timeline for d3ktqa1:

• d3ktqa1 first appeared (with stable ids) in SCOP 1.55
  
• d3ktqa1 appears in SCOP 1.65
  
• d3ktqa1 appears in SCOP 1.69
  
• d3ktqa1 appears in the current release, SCOPe 2.08