Lineage for d5hm7b_ (5hm7 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780621Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2780622Protein automated matches [190437] (70 species)
    not a true protein
  7. 2780893Species Human (Homo sapiens) [TaxId:9606] [187655] (109 PDB entries)
  8. 2781051Domain d5hm7b_: 5hm7 B: [336952]
    automated match to d4v1pa_
    complexed with bme, gol, mg

Details for d5hm7b_

PDB Entry: 5hm7 (more details), 1.93 Å

PDB Description: the intracellular domain of butyrophilin 3a1 protein
PDB Compounds: (B:) Butyrophilin subfamily 3 member A1

SCOPe Domain Sequences for d5hm7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hm7b_ b.29.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
erhsaynewkkalfkpadvildpktanpillvsedqrsvqrakepqdlpdnperfnwhyc
vlgcesfisgrhywevevgdrkewhigvcsknvqrkgwvkmtpengfwtmgltdgnkyrt
lteprtnlklpkppkkvgvfldyetgdisfynavdgshihtfldvsfsealypvfriltl
eptalticpa

SCOPe Domain Coordinates for d5hm7b_:

Click to download the PDB-style file with coordinates for d5hm7b_.
(The format of our PDB-style files is described here.)

Timeline for d5hm7b_: