Lineage for d1qtma1 (1qtm A:293-422)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 835945Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 836757Superfamily c.55.3: Ribonuclease H-like [53098] (14 families) (S)
    consists of one domain of this fold
  5. 837032Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (15 proteins)
    contains Pfam PF00929
  6. 837107Protein Exonuclease domain of prokaryotic DNA polymerase [53119] (3 species)
    part of Klenow fragment, KF
  7. 837170Species Thermus aquaticus [TaxId:271] [53121] (13 PDB entries)
  8. 837171Domain d1qtma1: 1qtm A:293-422 [33695]
    Other proteins in same PDB: d1qtma2
    protein/DNA complex; complexed with 2dt, mg, ttp

Details for d1qtma1

PDB Entry: 1qtm (more details), 2.3 Å

PDB Description: ddttp-trapped closed ternary complex of the large fragment of dna polymerase i from thermus aquaticus
PDB Compounds: (A:) DNA polymerase I

SCOP Domain Sequences for d1qtma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qtma1 c.55.3.5 (A:293-422) Exonuclease domain of prokaryotic DNA polymerase {Thermus aquaticus [TaxId: 271]}
aleeapwpppegafvgfvlsrkepmwadllalaaarggrvhrapepykalrdlkeargll
akdlsvlalreglglppgddpmllaylldpsnttpegvarryggewteeageraalserl
fanlwgrleg

SCOP Domain Coordinates for d1qtma1:

Click to download the PDB-style file with coordinates for d1qtma1.
(The format of our PDB-style files is described here.)

Timeline for d1qtma1: