Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423 |
Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) share with the family I the common active site structure with a circularly permuted topology |
Family c.45.1.3: Myotubularin-like phosphatases [102422] (2 proteins) common fold is decorated with additional structures |
Protein Myotubularin-related protein 2, C-terminal domain [102423] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [102424] (5 PDB entries) |
Domain d5gnha2: 5gnh A:199-586 [336942] Other proteins in same PDB: d5gnha1, d5gnhb1 automated match to d1zvra2 complexed with po4 |
PDB Entry: 5gnh (more details), 2.6 Å
SCOPe Domain Sequences for d5gnha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5gnha2 c.45.1.3 (A:199-586) Myotubularin-related protein 2, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} evfpengwklydplleyrrqgipneswritkineryelcdtypallvvpanipdeelkrv asfrsrgripvlswihpesqatitrcsqpmvgvsgkrskedekylqaimdsnaqshkifi fdarpsvnavankakgggyesedayqnaelvfldihnihvmreslrklkeivypnieeth wlsnlesthwlehiklilagalriadkvesgktsvvvhssdgwdrtaqltslamlmldgy yrtirgfevlvekewlsfghrfqlrvghgdknhadadrspvflqfidcvwqmtrqfptaf efneyflitildhlysclfgtflcnseqqrgkenlpkrtvslwsyinsqledftnplygs ysnhvlypvasmrhlelwvgyyirwnpr
Timeline for d5gnha2: