SCOPe 2.06: Domain d5gnha2: 5gnh A:199-586

Lineage for d5gnha2 (5gnh A:199-586)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.3: Myotubularin-like phosphatases [102422] (2 proteins)
   common fold is decorated with additional structures

6. Protein Myotubularin-related protein 2, C-terminal domain [102423] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [102424] (5 PDB entries)

8. Domain d5gnha2: 5gnh A:199-586 [336942]
   Other proteins in same PDB: d5gnha1, d5gnhb1
   automated match to d1zvra2
   complexed with po4

Details for d5gnha2

PDB Entry: 5gnh, 2.6 Å

PDB Description: myotubularin-related protein 2

PDB Compounds: (A:) Myotubularin-related protein 2

SCOPe Domain Sequences for d5gnha2:

Sequence; same for both SEQRES and ATOM records:

>d5gnha2 c.45.1.3 (A:199-586) Myotubularin-related protein 2, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
evfpengwklydplleyrrqgipneswritkineryelcdtypallvvpanipdeelkrv
asfrsrgripvlswihpesqatitrcsqpmvgvsgkrskedekylqaimdsnaqshkifi
fdarpsvnavankakgggyesedayqnaelvfldihnihvmreslrklkeivypnieeth
wlsnlesthwlehiklilagalriadkvesgktsvvvhssdgwdrtaqltslamlmldgy
yrtirgfevlvekewlsfghrfqlrvghgdknhadadrspvflqfidcvwqmtrqfptaf
efneyflitildhlysclfgtflcnseqqrgkenlpkrtvslwsyinsqledftnplygs
ysnhvlypvasmrhlelwvgyyirwnpr

Timeline for d5gnha2:

• d5gnha2 is new in SCOPe 2.06-stable
  
• d5gnha2 appears in SCOPe 2.07
  
• d5gnha2 appears in the current release, SCOPe 2.08