Lineage for d5gn6b2 (5gn6 B:263-511)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2137193Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2137194Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2138437Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 2138438Protein automated matches [226839] (52 species)
    not a true protein
  7. 2138978Species Trypanosoma brucei [TaxId:31285] [268052] (8 PDB entries)
  8. 2139006Domain d5gn6b2: 5gn6 B:263-511 [336939]
    Other proteins in same PDB: d5gn6a3, d5gn6b3, d5gn6c3, d5gn6d3
    automated match to d3wxla2
    complexed with 6y0, gol

Details for d5gn6b2

PDB Entry: 5gn6 (more details), 2.5 Å

PDB Description: crystal structure of glycerol kinase from trypanosoma brucei gambiense complexed with cumarin derivative-17b
PDB Compounds: (B:) glycerol kinase

SCOPe Domain Sequences for d5gn6b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gn6b2 c.55.1.0 (B:263-511) automated matches {Trypanosoma brucei [TaxId: 31285]}
mcfekgeakntygtgcfllmnvgeearfskhgllstvgfqvgrdgpcyyalegaiacaga
tvewmrrnmnlfshiteceklarsvpgtqgivfvpafsgllapywdpsargtivgmtlkt
trahviraalqaialqlndvvgsmkrdaglnlsslrvdgglskngllmeiqasllgvdil
vpsmhettalgaalcaglaagvwtsleevkavsrrenswktvspsgsamereamiaewre
alkrtkwak

SCOPe Domain Coordinates for d5gn6b2:

Click to download the PDB-style file with coordinates for d5gn6b2.
(The format of our PDB-style files is described here.)

Timeline for d5gn6b2: