SCOPe 2.07: Domain d5wcma_: 5wcm A:

Lineage for d5wcma_ (5wcm A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families)

5. Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)

6. Protein automated matches [190079] (12 species)
   not a true protein

7. Species Bradyrhizobium japonicum [TaxId:224911] [226051] (4 PDB entries)

8. Domain d5wcma_: 5wcm A: [336926]
   automated match to d3lvza_
   complexed with 4nz, zn

Details for d5wcma_

PDB Entry: 5wcm, 1.2 Å

PDB Description: crystal structure of the complex between class b3 beta-lactamase bjp-1 and 4-nitrobenzene-sulfonamide - new refinement

PDB Compounds: (A:) Blr6230 protein

SCOPe Domain Sequences for d5wcma_:

Sequence; same for both SEQRES and ATOM records:

>d5wcma_ d.157.1.1 (A:) automated matches {Bradyrhizobium japonicum [TaxId: 224911]}
kkwtapfepfqlidniyyvgtdgiavyviktsqglilmdtampqstgmikdniaklgfkv
adiklilnthahldhtggfaeikketgaqlvagerdkplleggyypgdeknedlafpavk
vdravkegdrvtlgdttltahatpghspgctswemtvkdgkedrevlffcsgtvalnrlv
gqptyagivddyratfakakamkidvllgphpevygmqakraemkdgapnpfikpgelvt
yatslsedfdkqlakqtaalekk

Timeline for d5wcma_:

• d5wcma_ first appeared in SCOPe 2.06
  
• d5wcma_ appears in the current release, SCOPe 2.08