Lineage for d1dpia1 (1dpi A:326-518)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1857400Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1859086Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 1859666Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (16 proteins)
    contains Pfam PF00929
  6. 1859846Protein Exonuclease domain of prokaryotic DNA polymerase [53119] (3 species)
    part of Klenow fragment, KF
  7. 1859896Species Escherichia coli [TaxId:562] [53120] (14 PDB entries)
  8. 1859908Domain d1dpia1: 1dpi A:326-518 [33692]
    Other proteins in same PDB: d1dpia2
    protein/DNA complex; complexed with zn

Details for d1dpia1

PDB Entry: 1dpi (more details), 2.8 Å

PDB Description: structure of large fragment of escherichia coli dna polymerase i complexed with d/tmp
PDB Compounds: (A:) DNA polymerase I klenow fragment

SCOPe Domain Sequences for d1dpia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dpia1 c.55.3.5 (A:326-518) Exonuclease domain of prokaryotic DNA polymerase {Escherichia coli [TaxId: 562]}
sydnyvtildeetlkawiaklekapvfafdtetdsldnisanlvglsfaiepgvaayipv
ahdyldapdqisreralellkplledekalkvgqnlkydrgilanygielrgiafdtmle
syilnsvagrhdmdslaerwlkhktitfeeiagkgknqltfnqialeeagryaaedadvt
lqlhlkmwpdlqk

SCOPe Domain Coordinates for d1dpia1:

Click to download the PDB-style file with coordinates for d1dpia1.
(The format of our PDB-style files is described here.)

Timeline for d1dpia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dpia2