Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily) consists of two intertwined (sub)domains related by pseudo dyad; duplication 3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest |
Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) the constituent families form similar dimers |
Family c.77.1.2: Monomeric isocitrate dehydrogenase [82526] (2 proteins) the active site is contained within one subunit between the canonical ICDH fold and a large insert domain that itself is a probable rudiment form of ICDH fold resulted from duplication, domain swapping and deletion automatically mapped to Pfam PF03971 |
Protein automated matches [190493] (6 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:83332] [336802] (1 PDB entry) |
Domain d5kvub_: 5kvu B: [336914] automated match to d2b0ta_ complexed with edo, gol, mla, mlt, nap, sin |
PDB Entry: 5kvu (more details), 2.66 Å
SCOPe Domain Sequences for d5kvub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5kvub_ c.77.1.2 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} ptiiytltdeapllatyaflpivrafaepagikieasdisvaarilaefpdylteeqrvp dnlaelgrltqlpdtniiklpnisasvpqlvaaikelqdkgyavpdypadpktdqekaik eryarclgsavnpvlrqgnsdrrapkavkeyarkhphsmgewsmasrthvahmrhgdfya geksmtldrarnvrmellaksgktivlkpevplddgdvidsmfmskkalcdfyeeqmqda fetgvmfslhvkatmmkvshpivfghavrifykdafakhqelfddlgvnvnnglsdlysk ieslpasqrdeiiedlhrchehrpelamvdsargisnfhspsdvivdasmpamiraggkm ygadgklkdtkavnpestfsriyqeiinfcktngqfdpttmgtvpnvglmaqqaeeygsh dktfeipedgvanivdvatgevlltenveagdiwrmcivkdapirdwvklavtrarisgm pvlfwldpyrphenelikkvktylkdhdtegldiqimsqvrsmrytcerlvrgldtiaat gnilrdyltdlfpilelgtsakmlsvvplmagggmyetgaggsapkhvkqlveenhlrwd slgeflalgagfedigiktgnerakllgktldaaigklldndkspsrktgeldnrgsqfy lamywaqelaaqtddqqlaehfasladvltknedvivreltevqgepvdiggyyapdsdm ttavmrpsktfnaaleav
Timeline for d5kvub_: