Lineage for d5krpd_ (5krp D:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2079052Fold b.77: beta-Prism I [51091] (3 superfamilies)
    consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
    duplication: has internal pseudo threefold symmetry
  4. 2079092Superfamily b.77.3: Mannose-binding lectins [51101] (2 families) (S)
  5. 2079093Family b.77.3.1: Mannose-binding lectins [51102] (7 proteins)
  6. 2079205Protein automated matches [190387] (3 species)
    not a true protein
  7. 2079206Species Artocarpus altilis [TaxId:194251] [336810] (3 PDB entries)
  8. 2079210Domain d5krpd_: 5krp D: [336911]
    automated match to d1j4ta_
    complexed with gol

Details for d5krpd_

PDB Entry: 5krp (more details), 1.58 Å

PDB Description: frutapin, a lectin from artocarpus incisa: cloning, expressing and structural analysis.
PDB Compounds: (D:) Frutapin

SCOPe Domain Sequences for d5krpd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5krpd_ b.77.3.1 (D:) automated matches {Artocarpus altilis [TaxId: 194251]}
masqtitvgpwggpggnewddgsytgiriielsykeaigsfsviydlngepfsgskhtsk
lpytnvkielqfpeeflvsvsgytapfsslatrtpvvrslkfktnkgrtfgpygeedgty
fnlpienglvvgfkgrtgdlldaigvhmal

SCOPe Domain Coordinates for d5krpd_:

Click to download the PDB-style file with coordinates for d5krpd_.
(The format of our PDB-style files is described here.)

Timeline for d5krpd_: