SCOPe 2.04: Domain d1d9fa1: 1d9f A:324-518

Lineage for d1d9fa1 (1d9f A:324-518)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (16 proteins)
   contains Pfam PF00929

6. Protein Exonuclease domain of prokaryotic DNA polymerase [53119] (3 species)
   part of Klenow fragment, KF

7. Species Escherichia coli [TaxId:562] [53120] (14 PDB entries)

8. Domain d1d9fa1: 1d9f A:324-518 [33691]
   Other proteins in same PDB: d1d9fa2
   protein/DNA complex; protein/RNA complex; complexed with so4, zn

Details for d1d9fa1

PDB Entry: 1d9f, 3 Å

PDB Description: crystal structure of the complex of dna polymerase i klenow fragment with dna tetramer carrying 2'-o-(3-aminopropyl)-rna modification 5'- d(tt)-ap(u)-d(t)-3'

PDB Compounds: (A:) DNA polymerase I

SCOPe Domain Sequences for d1d9fa1:

Sequence; same for both SEQRES and ATOM records:

>d1d9fa1 c.55.3.5 (A:324-518) Exonuclease domain of prokaryotic DNA polymerase {Escherichia coli [TaxId: 562]}
misydnyvtildeetlkawiaklekapvfafdtetdsldnisanlvglsfaiepgvaayi
pvahdyldapdqisreralellkplledekalkvgqnlkydrgilanygielrgiafdtm
lesyilnsvagrhdmdslaerwlkhktitfeeiagkgknqltfnqialeeagryaaedad
vtlqlhlkmwpdlqk

Timeline for d1d9fa1:

• d1d9fa1 first appeared (with stable ids) in SCOP 1.55
  
• d1d9fa1 appears in SCOPe 2.03
  
• d1d9fa1 appears in SCOPe 2.05
  
• d1d9fa1 appears in the current release, SCOPe 2.08