Lineage for d1d9fa1 (1d9f A:324-518)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 25007Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
  4. 25212Superfamily c.55.3: Ribonuclease H-like [53098] (6 families) (S)
  5. 25363Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (4 proteins)
  6. 25384Protein Exonuclease domain of prokaryotic DNA polymerase [53119] (3 species)
  7. 25390Species Escherichia coli [TaxId:562] [53120] (14 PDB entries)
  8. 25401Domain d1d9fa1: 1d9f A:324-518 [33691]
    Other proteins in same PDB: d1d9fa2

Details for d1d9fa1

PDB Entry: 1d9f (more details), 3 Å

PDB Description: crystal structure of the complex of dna polymerase i klenow fragment with dna tetramer carrying 2'-o-(3-aminopropyl)-rna modification 5'- d(tt)-ap(u)-d(t)-3'

SCOP Domain Sequences for d1d9fa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d9fa1 c.55.3.5 (A:324-518) Exonuclease domain of prokaryotic DNA polymerase {Escherichia coli}
misydnyvtildeetlkawiaklekapvfafdtetdsldnisanlvglsfaiepgvaayi
pvahdyldapdqisreralellkplledekalkvgqnlkydrgilanygielrgiafdtm
lesyilnsvagrhdmdslaerwlkhktitfeeiagkgknqltfnqialeeagryaaedad
vtlqlhlkmwpdlqk

SCOP Domain Coordinates for d1d9fa1:

Click to download the PDB-style file with coordinates for d1d9fa1.
(The format of our PDB-style files is described here.)

Timeline for d1d9fa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1d9fa2