Lineage for d5wtad1 (5wta D:273-418)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2767182Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2767438Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 2767842Family b.2.3.0: automated matches [191391] (1 protein)
    not a true family
  6. 2767843Protein automated matches [190503] (10 species)
    not a true protein
  7. 2767912Species Staphylococcus aureus [TaxId:158878] [336878] (2 PDB entries)
  8. 2767920Domain d5wtad1: 5wta D:273-418 [336909]
    automated match to d1r17a1

Details for d5wtad1

PDB Entry: 5wta (more details), 2.3 Å

PDB Description: crystal structure of staphylococcus aureus sdre apo form
PDB Compounds: (D:) Serine-aspartate repeat-containing protein E

SCOPe Domain Sequences for d5wtad1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wtad1 b.2.3.0 (D:273-418) automated matches {Staphylococcus aureus [TaxId: 158878]}
nnvndlitvtkqtikvgdgkdnvaaahdgkdieydteftidnkvkkgdtmtinydknvip
sdltdkndpiditdpsgeviakgtfdkatkqitytftdyvdkyedikarltlysyidkqa
vpnetslnltfatagketsqnvsvdy

SCOPe Domain Coordinates for d5wtad1:

Click to download the PDB-style file with coordinates for d5wtad1.
(The format of our PDB-style files is described here.)

Timeline for d5wtad1: