| Class b: All beta proteins [48724] (180 folds) |
| Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.3: Bacterial adhesins [49401] (7 families) ![]() |
| Family b.2.3.0: automated matches [191391] (1 protein) not a true family |
| Protein automated matches [190503] (10 species) not a true protein |
| Species Staphylococcus aureus [TaxId:158878] [336878] (2 PDB entries) |
| Domain d5wtad1: 5wta D:273-418 [336909] automated match to d1r17a1 |
PDB Entry: 5wta (more details), 2.3 Å
SCOPe Domain Sequences for d5wtad1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5wtad1 b.2.3.0 (D:273-418) automated matches {Staphylococcus aureus [TaxId: 158878]}
nnvndlitvtkqtikvgdgkdnvaaahdgkdieydteftidnkvkkgdtmtinydknvip
sdltdkndpiditdpsgeviakgtfdkatkqitytftdyvdkyedikarltlysyidkqa
vpnetslnltfatagketsqnvsvdy
Timeline for d5wtad1: