SCOPe 2.07: Domain d5knra_: 5knr A:

Lineage for d5knra_ (5knr A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)

6. Protein automated matches [190074] (15 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [336800] (6 PDB entries)

8. Domain d5knra_: 5knr A: [336908]
   automated match to d1g9sa_
   complexed with 3l5, mg

Details for d5knra_

PDB Entry: 5knr, 2.86 Å

PDB Description: e. coli hprt in complexed with 9-[(n-phosphonoethyl-n- phosphonoethoxyethyl)-2-aminoethyl]-guanine

PDB Compounds: (A:) hypoxanthine-guanine phosphoribosyltransferase

SCOPe Domain Sequences for d5knra_:

Sequence, based on SEQRES records:

>d5knra_ c.61.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
mkhtvevmipeaeikariaelgrqiterykdsgsdmvlvgllrgsfmfmadlcrevqvsh
evdfmtassygsgmsttrdvkilkdldedirgkdvlivediidsgntlskvreilslrep
kslaictlldkpsrrevnvpvefigfsipdefvvgygidyaqryrhlpyigkvilld

Sequence, based on observed residues (ATOM records):

>d5knra_ c.61.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
mkhtvevmipeaeikariaelgrqiterykdsgsdmvlvgllrgsfmfmadlcrevqvsh
evdfmtassygtrdvkilkdldedirgkdvlivediidsgntlskvreilslrepkslai
ctlldkpsrrevnvpvefigfsipdefvvgygidyaqryrhlpyigkvilld

Timeline for d5knra_:

• d5knra_ first appeared in SCOPe 2.06
  
• d5knra_ appears in the current release, SCOPe 2.08