SCOP 1.73: Domain d2kzma1: 2kzm A:324-518

Lineage for d2kzma1 (2kzm A:324-518)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (12 families)
   consists of one domain of this fold

5. Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (14 proteins)
   contains Pfam PF00929

6. Protein Exonuclease domain of prokaryotic DNA polymerase [53119] (3 species)
   part of Klenow fragment, KF

7. Species Escherichia coli [TaxId:562] [53120] (14 PDB entries)

8. Domain d2kzma1: 2kzm A:324-518 [33690]
   Other proteins in same PDB: d2kzma2
   protein/DNA complex; complexed with mn, zn

Details for d2kzma1

PDB Entry: 2kzm, 2.6 Å

PDB Description: klenow fragment with normal substrate and zinc and manganese

PDB Compounds: (A:) protein (DNA polymerase I)

SCOP Domain Sequences for d2kzma1:

Sequence; same for both SEQRES and ATOM records:

>d2kzma1 c.55.3.5 (A:324-518) Exonuclease domain of prokaryotic DNA polymerase {Escherichia coli [TaxId: 562]}
misydnyvtildeetlkawiaklekapvfafdtetdsldnisanlvglsfaiepgvaayi
pvahdyldapdqisreralellkplledekalkvgqnlkydrgilanygielrgiafdtm
lesyilnsvagrhdmdslaerwlkhktitfeeiagkgknqltfnqialeeagryaaedad
vtlqlhlkmwpdlqk

Timeline for d2kzma1:

• d2kzma1 first appeared (with stable ids) in SCOP 1.55
  
• d2kzma1 appears in SCOP 1.71
  
• d2kzma1 appears in SCOP 1.75
  
• d2kzma1 appears in the current release, SCOPe 2.08