Lineage for d5wdpa_ (5wdp A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2446887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2446888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2447791Family c.37.1.8: G proteins [52592] (80 protein domains)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2447934Protein cH-p21 Ras protein [52593] (1 species)
  7. 2447935Species Human (Homo sapiens) [TaxId:9606] [52594] (120 PDB entries)
    Uniprot Q6P716
  8. 2447952Domain d5wdpa_: 5wdp A: [336883]
    automated match to d2q21a_
    complexed with ca, gnp, mg; mutant

Details for d5wdpa_

PDB Entry: 5wdp (more details), 1.35 Å

PDB Description: h-ras mutant l120a bound to gmp-pnp at 277k
PDB Compounds: (A:) gtpase hras

SCOPe Domain Sequences for d5wdpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wdpa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcda
aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh

SCOPe Domain Coordinates for d5wdpa_:

Click to download the PDB-style file with coordinates for d5wdpa_.
(The format of our PDB-style files is described here.)

Timeline for d5wdpa_: