Lineage for d5ue2a1 (5ue2 A:1-72)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2697917Fold a.20: PGBD-like [47089] (1 superfamily)
    core: 3 helices; bundle, closed, left-handed twist; parallel
  4. 2697918Superfamily a.20.1: PGBD-like [47090] (3 families) (S)
  5. 2697948Family a.20.1.0: automated matches [336862] (1 protein)
    not a true family
  6. 2697949Protein automated matches [336863] (1 species)
    not a true protein
  7. 2697950Species Human (Homo sapiens) [TaxId:9606] [336864] (5 PDB entries)
  8. 2697952Domain d5ue2a1: 5ue2 A:1-72 [336876]
    Other proteins in same PDB: d5ue2a2
    automated match to d1slma1
    complexed with ca, zn

Details for d5ue2a1

PDB Entry: 5ue2 (more details)

PDB Description: prommp-7 with heparin octasaccharide bridging between domains
PDB Compounds: (A:) Matrilysin

SCOPe Domain Sequences for d5ue2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ue2a1 a.20.1.0 (A:1-72) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pqeaggmselqweqaqdylkrfylydsetknansleaklkemqkffglpitgmlnsrvie
imqkprcgvpdv

SCOPe Domain Coordinates for d5ue2a1:

Click to download the PDB-style file with coordinates for d5ue2a1.
(The format of our PDB-style files is described here.)

Timeline for d5ue2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5ue2a2