![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.20: PGBD-like [47089] (1 superfamily) core: 3 helices; bundle, closed, left-handed twist; parallel |
![]() | Superfamily a.20.1: PGBD-like [47090] (3 families) ![]() |
![]() | Family a.20.1.0: automated matches [336862] (1 protein) not a true family |
![]() | Protein automated matches [336863] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [336864] (5 PDB entries) |
![]() | Domain d5ue2a1: 5ue2 A:1-72 [336876] Other proteins in same PDB: d5ue2a2 automated match to d1slma1 complexed with ca, zn |
PDB Entry: 5ue2 (more details)
SCOPe Domain Sequences for d5ue2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ue2a1 a.20.1.0 (A:1-72) automated matches {Human (Homo sapiens) [TaxId: 9606]} pqeaggmselqweqaqdylkrfylydsetknansleaklkemqkffglpitgmlnsrvie imqkprcgvpdv
Timeline for d5ue2a1: