![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.77: beta-Prism I [51091] (3 superfamilies) consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis duplication: has internal pseudo threefold symmetry |
![]() | Superfamily b.77.3: Mannose-binding lectins [51101] (2 families) ![]() |
![]() | Family b.77.3.1: Mannose-binding lectins [51102] (7 protein domains) |
![]() | Protein automated matches [190387] (4 species) not a true protein |
![]() | Species Artocarpus altilis [TaxId:194251] [336810] (3 PDB entries) |
![]() | Domain d5krpa_: 5krp A: [336874] automated match to d1j4ta_ complexed with gol |
PDB Entry: 5krp (more details), 1.58 Å
SCOPe Domain Sequences for d5krpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5krpa_ b.77.3.1 (A:) automated matches {Artocarpus altilis [TaxId: 194251]} masqtitvgpwggpggnewddgsytgiriielsykeaigsfsviydlngepfsgskhtsk lpytnvkielqfpeeflvsvsgytapfsslatrtpvvrslkfktnkgrtfgpygeedgty fnlpienglvvgfkgrtgdlldaigvhmal
Timeline for d5krpa_: