Lineage for d5krpa_ (5krp A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2402521Fold b.77: beta-Prism I [51091] (3 superfamilies)
    consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
    duplication: has internal pseudo threefold symmetry
  4. 2402563Superfamily b.77.3: Mannose-binding lectins [51101] (2 families) (S)
  5. 2402564Family b.77.3.1: Mannose-binding lectins [51102] (7 protein domains)
  6. 2402676Protein automated matches [190387] (4 species)
    not a true protein
  7. 2402677Species Artocarpus altilis [TaxId:194251] [336810] (3 PDB entries)
  8. 2402678Domain d5krpa_: 5krp A: [336874]
    automated match to d1j4ta_
    complexed with gol

Details for d5krpa_

PDB Entry: 5krp (more details), 1.58 Å

PDB Description: frutapin, a lectin from artocarpus incisa: cloning, expressing and structural analysis.
PDB Compounds: (A:) Frutapin

SCOPe Domain Sequences for d5krpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5krpa_ b.77.3.1 (A:) automated matches {Artocarpus altilis [TaxId: 194251]}
masqtitvgpwggpggnewddgsytgiriielsykeaigsfsviydlngepfsgskhtsk
lpytnvkielqfpeeflvsvsgytapfsslatrtpvvrslkfktnkgrtfgpygeedgty
fnlpienglvvgfkgrtgdlldaigvhmal

SCOPe Domain Coordinates for d5krpa_:

Click to download the PDB-style file with coordinates for d5krpa_.
(The format of our PDB-style files is described here.)

Timeline for d5krpa_: