Lineage for d5ue5a2 (5ue5 A:73-247)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2204982Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2204983Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2206178Family d.92.1.0: automated matches [191495] (1 protein)
    not a true family
  6. 2206179Protein automated matches [190805] (17 species)
    not a true protein
  7. 2206207Species Human (Homo sapiens) [TaxId:9606] [188286] (43 PDB entries)
  8. 2206291Domain d5ue5a2: 5ue5 A:73-247 [336867]
    Other proteins in same PDB: d5ue5a1
    automated match to d1slma2
    complexed with ca, ids, sgn, zn

Details for d5ue5a2

PDB Entry: 5ue5 (more details)

PDB Description: prommp-7 with heparin octasaccharide bound to the catalytic domain
PDB Compounds: (A:) Matrilysin

SCOPe Domain Sequences for d5ue5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ue5a2 d.92.1.0 (A:73-247) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aeyslfpnspkwtskvvtyrivsytrdlphitvdrlvskalnmwgkeiplhfrkvvwgta
dimigfargahgdsypfdgpgntlahafapgtglggdahfdederwtdgsslginflyaa
thalghslgmghssdpnavmyptygngdpqnfklsqddikgiqklygkrsnsrkk

SCOPe Domain Coordinates for d5ue5a2:

Click to download the PDB-style file with coordinates for d5ue5a2.
(The format of our PDB-style files is described here.)

Timeline for d5ue5a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5ue5a1