SCOPe 2.08: Domain d5ue5a2: 5ue5 A:73-247

Lineage for d5ue5a2 (5ue5 A:73-247)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families)

5. Family d.92.1.0: automated matches [191495] (1 protein)
   not a true family

6. Protein automated matches [190805] (20 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188286] (69 PDB entries)

8. Domain d5ue5a2: 5ue5 A:73-247 [336867]
   Other proteins in same PDB: d5ue5a1
   automated match to d1slma2
   complexed with ca, zn

Details for d5ue5a2

PDB Entry: 5ue5

PDB Description: prommp-7 with heparin octasaccharide bound to the catalytic domain

PDB Compounds: (A:) Matrilysin

SCOPe Domain Sequences for d5ue5a2:

Sequence; same for both SEQRES and ATOM records:

>d5ue5a2 d.92.1.0 (A:73-247) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aeyslfpnspkwtskvvtyrivsytrdlphitvdrlvskalnmwgkeiplhfrkvvwgta
dimigfargahgdsypfdgpgntlahafapgtglggdahfdederwtdgsslginflyaa
thalghslgmghssdpnavmyptygngdpqnfklsqddikgiqklygkrsnsrkk

Timeline for d5ue5a2:

• d5ue5a2 first appeared in SCOPe 2.06
  
• d5ue5a2 appears in SCOPe 2.07