| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) ![]() |
| Family d.92.1.0: automated matches [191495] (1 protein) not a true family |
| Protein automated matches [190805] (20 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [188286] (69 PDB entries) |
| Domain d5ue5a2: 5ue5 A:73-247 [336867] Other proteins in same PDB: d5ue5a1 automated match to d1slma2 complexed with ca, zn |
PDB Entry: 5ue5 (more details)
SCOPe Domain Sequences for d5ue5a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ue5a2 d.92.1.0 (A:73-247) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aeyslfpnspkwtskvvtyrivsytrdlphitvdrlvskalnmwgkeiplhfrkvvwgta
dimigfargahgdsypfdgpgntlahafapgtglggdahfdederwtdgsslginflyaa
thalghslgmghssdpnavmyptygngdpqnfklsqddikgiqklygkrsnsrkk
Timeline for d5ue5a2: