SCOPe 2.08: Domain d5ue5a1: 5ue5 A:1-72

Lineage for d5ue5a1 (5ue5 A:1-72)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.20: PGBD-like [47089] (1 superfamily)
   core: 3 helices; bundle, closed, left-handed twist; parallel

4. Superfamily a.20.1: PGBD-like [47090] (3 families)

5. Family a.20.1.0: automated matches [336862] (1 protein)
   not a true family

6. Protein automated matches [336863] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [336864] (5 PDB entries)

8. Domain d5ue5a1: 5ue5 A:1-72 [336865]
   Other proteins in same PDB: d5ue5a2
   automated match to d1slma1
   complexed with ca, zn

Details for d5ue5a1

PDB Entry: 5ue5

PDB Description: prommp-7 with heparin octasaccharide bound to the catalytic domain

PDB Compounds: (A:) Matrilysin

SCOPe Domain Sequences for d5ue5a1:

Sequence; same for both SEQRES and ATOM records:

>d5ue5a1 a.20.1.0 (A:1-72) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pqeaggmselqweqaqdylkrfylydsetknansleaklkemqkffglpitgmlnsrvie
imqkprcgvpdv

Timeline for d5ue5a1:

• d5ue5a1 first appeared in SCOPe 2.06
  
• d5ue5a1 appears in SCOPe 2.07