Lineage for d5kkxb2 (5kkx B:469-612)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2575768Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
  4. 2575769Superfamily f.4.1: OMPA-like [56925] (5 families) (S)
    forms (8,10) barrel
  5. 2575840Family f.4.1.0: automated matches [191664] (1 protein)
    not a true family
  6. 2575841Protein automated matches [191257] (5 species)
    not a true protein
  7. 2575864Species Neisseria meningitidis [TaxId:487] [256195] (2 PDB entries)
  8. 2575867Domain d5kkxb2: 5kkx B:469-612 [336857]
    Other proteins in same PDB: d5kkxa1, d5kkxb1
    automated match to d3pqsa4
    complexed with gol; mutant

Details for d5kkxb2

PDB Entry: 5kkx (more details), 2.1 Å

PDB Description: crystal structure of a tbpb c-lobe mutant from neisseria meningitidis m982
PDB Compounds: (B:) TbpB

SCOPe Domain Sequences for d5kkxb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kkxb2 f.4.1.0 (B:469-612) automated matches {Neisseria meningitidis [TaxId: 487]}
dekeiptdqnvvyrgswyghiangtswsgnasdkeggnraeftvnfadkkitgkltaenr
qaqtftiegmiqgngfegtaktaesgfdldqknttrtpkayitdakvkggfygpkaeelg
gwfayhksdngsatvvfgakrqqp

SCOPe Domain Coordinates for d5kkxb2:

Click to download the PDB-style file with coordinates for d5kkxb2.
(The format of our PDB-style files is described here.)

Timeline for d5kkxb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5kkxb1