Lineage for d5kkxb1 (5kkx B:379-468)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2413175Fold b.181: Handle domain of Transferrin binding protein TbpB-like [310564] (1 superfamily)
    2 layers; antiparallel B-sheet, order 1432 or 216543, flanked by alpha helix or 2-strand beta hairpin
  4. 2413176Superfamily b.181.1: Handle domain of Transferrin binding protein TbpB-like [310592] (2 families) (S)
    C-terminal part of Pfam PF01298
  5. 2413185Family b.181.1.0: automated matches [310674] (1 protein)
    not a true family
  6. 2413186Protein automated matches [310874] (3 species)
    not a true protein
  7. 2413209Species Neisseria meningitidis [TaxId:487] [336817] (1 PDB entry)
  8. 2413211Domain d5kkxb1: 5kkx B:379-468 [336856]
    Other proteins in same PDB: d5kkxa2, d5kkxb2
    automated match to d3pqsa3
    complexed with gol; mutant

Details for d5kkxb1

PDB Entry: 5kkx (more details), 2.1 Å

PDB Description: crystal structure of a tbpb c-lobe mutant from neisseria meningitidis m982
PDB Compounds: (B:) TbpB

SCOPe Domain Sequences for d5kkxb1:

Sequence, based on SEQRES records: (download)

>d5kkxb1 b.181.1.0 (B:379-468) automated matches {Neisseria meningitidis [TaxId: 487]}
ttvldaveltlndkkiknldnfsnaaqlvvdgimidlagteftrkfehtingktyevevc
csnlnylkygmltrkgkqveqsmflqgert

Sequence, based on observed residues (ATOM records): (download)

>d5kkxb1 b.181.1.0 (B:379-468) automated matches {Neisseria meningitidis [TaxId: 487]}
ttvldaveltlndkkiknldnfsnaaqlvvdgimidlaeftrkfehtingktyevevccs
nlnylkygmltrkgkqveqsmflqgert

SCOPe Domain Coordinates for d5kkxb1:

Click to download the PDB-style file with coordinates for d5kkxb1.
(The format of our PDB-style files is described here.)

Timeline for d5kkxb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5kkxb2