SCOPe 2.08: Domain d5gmsb_: 5gms B:

Lineage for d5gmsb_ (5gms B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (131 species)
   not a true protein

7. Species Uncultured bacterium [TaxId:77133] [196706] (50 PDB entries)

8. Domain d5gmsb_: 5gms B: [336854]
   automated match to d3faka_
   mutant

Details for d5gmsb_

PDB Entry: 5gms, 1.7 Å

PDB Description: crystal structure of the mutant s202w/i203f of the esterase e40

PDB Compounds: (B:) esterase

SCOPe Domain Sequences for d5gmsb_:

Sequence; same for both SEQRES and ATOM records:

>d5gmsb_ c.69.1.0 (B:) automated matches {Uncultured bacterium [TaxId: 77133]}
makspeldrvigmireraatprkttdddrrlyetmlgsmpldddiqterlgvngvpaewi
yapgarddqvflylhgggyvigsmrthrvmlshiaraagcrvlgldyrlapetpfpapve
dtvaayrwllahgydpsrialggdsaggglvvaalvalryigeplpaagvclspwidmea
tgesfttnatmdpsvnkervmwfaalylggknpqaplasplyadlqglppllvqvggiet
llddaralttrakaagvdadlevwddmphvwqhfapilpegkqaiarigeflrkqig

Timeline for d5gmsb_:

• d5gmsb_ first appeared in SCOPe 2.06
  
• d5gmsb_ appears in SCOPe 2.07