Lineage for d5m6od_ (5m6o D:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2422560Fold b.77: beta-Prism I [51091] (3 superfamilies)
    consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
    duplication: has internal pseudo threefold symmetry
  4. 2422610Superfamily b.77.3: Mannose-binding lectins [51101] (2 families) (S)
  5. 2422611Family b.77.3.1: Mannose-binding lectins [51102] (7 proteins)
  6. 2422723Protein automated matches [190387] (4 species)
    not a true protein
  7. 2422724Species Artocarpus altilis [TaxId:194251] [336810] (3 PDB entries)
  8. 2422736Domain d5m6od_: 5m6o D: [336852]
    automated match to d1j4ta_
    complexed with man

Details for d5m6od_

PDB Entry: 5m6o (more details), 1.7 Å

PDB Description: frutapin complexed with alpha-d-mannose
PDB Compounds: (D:) Frutapin

SCOPe Domain Sequences for d5m6od_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5m6od_ b.77.3.1 (D:) automated matches {Artocarpus altilis [TaxId: 194251]}
masqtitvgpwggpggnewddgsytgiriielsykeaigsfsviydlngepfsgskhtsk
lpytnvkielqfpeeflvsvsgytapfsslatrtpvvrslkfktnkgrtfgpygeedgty
fnlpienglvvgfkgrtgdlldaigvhmal

SCOPe Domain Coordinates for d5m6od_:

Click to download the PDB-style file with coordinates for d5m6od_.
(The format of our PDB-style files is described here.)

Timeline for d5m6od_: