Lineage for d5o0va2 (5o0v A:150-313)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2203126Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 2203127Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 2203128Family d.81.1.1: GAPDH-like [55348] (6 proteins)
    has many additional secondary structures
  6. 2203219Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (20 species)
  7. 2203295Species Escherichia coli [TaxId:83334] [336838] (1 PDB entry)
  8. 2203296Domain d5o0va2: 5o0v A:150-313 [336839]
    Other proteins in same PDB: d5o0va1
    automated match to d1gado2
    complexed with gol

Details for d5o0va2

PDB Entry: 5o0v (more details), 2.4 Å

PDB Description: crystal structure of e. coli gap-dh by fortuitous crystallization as an impurity from a solution of human liver fbpase
PDB Compounds: (A:) glyceraldehyde-3-phosphate dehydrogenase a

SCOPe Domain Sequences for d5o0va2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5o0va2 d.81.1.1 (A:150-313) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli [TaxId: 83334]}
cttnclaplakvindnfgiieglmttvhattatqktvdgpshkdwrggrgasqniipsst
gaakavgkvlpelngkltgmafrvptpnvsvvdltvrlekaatyeqikaavkaaaegemk
gvlgyteddvvstdfngevctsvfdakagialndnfvklvswyd

SCOPe Domain Coordinates for d5o0va2:

Click to download the PDB-style file with coordinates for d5o0va2.
(The format of our PDB-style files is described here.)

Timeline for d5o0va2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5o0va1