Lineage for d5o0va1 (5o0v A:2-149,A:314-331)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2426096Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2426097Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2428331Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 protein domains)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 2428572Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (21 species)
  7. 2428648Species Escherichia coli [TaxId:83334] [336836] (1 PDB entry)
  8. 2428649Domain d5o0va1: 5o0v A:2-149,A:314-331 [336837]
    Other proteins in same PDB: d5o0va2
    automated match to d1gado1
    complexed with gol

Details for d5o0va1

PDB Entry: 5o0v (more details), 2.4 Å

PDB Description: crystal structure of e. coli gap-dh by fortuitous crystallization as an impurity from a solution of human liver fbpase
PDB Compounds: (A:) glyceraldehyde-3-phosphate dehydrogenase a

SCOPe Domain Sequences for d5o0va1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5o0va1 c.2.1.3 (A:2-149,A:314-331) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli [TaxId: 83334]}
tikvgingfgrigrivfraaqkrsdieivaindlldadymaymlkydsthgrfdgtvevk
dghlivngkkirvtaerdpanlkwdevgvdvvaeatglfltdetarkhitagakkvvmtg
pskdntpmfvkganfdkyagqdivsnasXnetgysnkvldliahisk

SCOPe Domain Coordinates for d5o0va1:

Click to download the PDB-style file with coordinates for d5o0va1.
(The format of our PDB-style files is described here.)

Timeline for d5o0va1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5o0va2