SCOPe 2.08: Domain d5o0va1: 5o0v A:2-149,A:314-331

Lineage for d5o0va1 (5o0v A:2-149,A:314-331)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
   family members also share a common alpha+beta fold in C-terminal domain

6. Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (21 species)

7. Species Escherichia coli [TaxId:83334] [336836] (1 PDB entry)

8. Domain d5o0va1: 5o0v A:2-149,A:314-331 [336837]
   Other proteins in same PDB: d5o0va2
   automated match to d1gado1
   complexed with gol

Details for d5o0va1

PDB Entry: 5o0v, 2.4 Å

PDB Description: crystal structure of e. coli gap-dh by fortuitous crystallization as an impurity from a solution of human liver fbpase

PDB Compounds: (A:) glyceraldehyde-3-phosphate dehydrogenase a

SCOPe Domain Sequences for d5o0va1:

Sequence; same for both SEQRES and ATOM records:

>d5o0va1 c.2.1.3 (A:2-149,A:314-331) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli [TaxId: 83334]}
tikvgingfgrigrivfraaqkrsdieivaindlldadymaymlkydsthgrfdgtvevk
dghlivngkkirvtaerdpanlkwdevgvdvvaeatglfltdetarkhitagakkvvmtg
pskdntpmfvkganfdkyagqdivsnasXnetgysnkvldliahisk

Timeline for d5o0va1:

• d5o0va1 first appeared in SCOPe 2.06
  
• d5o0va1 appears in SCOPe 2.07