Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
Superfamily c.61.1: PRTase-like [53271] (3 families) |
Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins) |
Protein automated matches [190074] (15 species) not a true protein |
Species Escherichia coli [TaxId:562] [336800] (6 PDB entries) |
Domain d5knxb_: 5knx B: [336835] automated match to d1g9sa_ complexed with 6wc, mg |
PDB Entry: 5knx (more details), 2.4 Å
SCOPe Domain Sequences for d5knxb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5knxb_ c.61.1.1 (B:) automated matches {Escherichia coli [TaxId: 562]} dmkhtvevmipeaeikariaelgrqiterykdsgsdmvlvgllrgsfmfmadlcrevqvs hevdfmtassygsgmsttrdvkilkdldedirgkdvlivediidsgntlskvreilslre pkslaictlldkpsrrevnvpvefigfsipdefvvgygidyaqryrhlpyigkvil
Timeline for d5knxb_: